Protein Info for LRK54_RS06890 in Rhodanobacter denitrificans FW104-10B01

Annotation: 2Fe-2S iron-sulfur cluster-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 8 to 84 (77 residues), 58.4 bits, E=8.6e-20
• PF00970: FAD_binding_6
  • amino acids 108 to 200 (93 residues), 48.9 bits, E=1.1e-16
• PF00175: NAD_binding_1
  • amino acids 212 to 315 (104 residues), 67.7 bits, E=2e-22

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 47% identity to bph:Bphy_0596)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like" in subsystem Central meta-cleavage pathway of aromatic compound degradation

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (1/3 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (1/8 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Protein Sequence (355 amino acids)

>LRK54_RS06890 2Fe-2S iron-sulfur cluster-binding protein (Rhodanobacter denitrificans FW104-10B01)
MHPVPIVTLKSSGRQFPVAIGETVLEAAQRAGVALPYSCRAGVCGSCKATLLEGRCEYPR
NPPLALDAGALAHHAVLPCQAVPCGDLLLEAREVASVEDIARRQLGVVVADKWRLAADVI
GLRLQPDRGERRLRRLPGQYLDVLLEDGRRRPFSIANGPQRDGSIELHVRHVAGGGFTSW
VNDVLGVGDRLRVEGPLGTFVPREDSERPMIFMAGGTGFAPVKAIVEHFIALGTRRPMRL
YWGARSAADLYLRALAEQWAREVPNLAFHAVVSHPALAEGLRTGLVHEAVLADQPDLAGH
DLYMSGPPAMIDAAHPGFLAAGLPEERLYYDSFEYAPDVLAAIIAGRAGIHDLPL