Protein Info for LRK54_RS06875 in Rhodanobacter denitrificans FW104-10B01

Annotation: YiiD C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 56 to 75 (20 residues), see Phobius details PF09500: YiiD_C" amino acids 12 to 154 (143 residues), 124 bits, see alignment E=2.4e-40 TIGR02447: putative thioesterase domain" amino acids 20 to 153 (134 residues), 124.4 bits, see alignment E=1.5e-40

Best Hits

KEGG orthology group: None (inferred from 49% identity to xal:XALc_3082)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>LRK54_RS06875 YiiD C-terminal domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MSTTDDATLHAQQLIRFIRDEIPLARAMDLQLADCSDDRLSLRAPLAPNVNDKGCAFGGS
LVSLMTLSGWALVELALRRRSLDCDVFVAESSVRYLVPLWQDFRSEARLAAEADWATFFS
TLEARGKARIGVDCVVPDQHGAPACTLSARFVAKRRG