Protein Info for LRK54_RS06830 in Rhodanobacter denitrificans FW104-10B01
Annotation: glutathione S-transferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 72% identity to sml:Smlt3734)Predicted SEED Role
"Glutathione S-transferase"
MetaCyc Pathways
- 4-hydroxy-2-nonenal detoxification (1/4 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- pentachlorophenol degradation (3/10 steps found)
- gliotoxin biosynthesis (1/9 steps found)
- glutathione-mediated detoxification II (1/9 steps found)
- indole glucosinolate activation (intact plant cell) (3/12 steps found)
- camalexin biosynthesis (2/12 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.18
Use Curated BLAST to search for 2.5.1.18
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (236 amino acids)
>LRK54_RS06830 glutathione S-transferase (Rhodanobacter denitrificans FW104-10B01) MRYELYYWTGIQGRGEFVRLALEDAGASYVDVAREEGDDAIVRYLDGVHEGALPFAPPFL KAGRLLIAQTANILQYLGPPLGLVPESESRRLYAHQLQLTIADLVAEVHDSHHPIASSLY YEDQRVEARRRAADLRETRLPKYLDYFEQVLERGGGEHALHGHSYVDLSLFQLISGLEYA YPRAMQRLAHKLPLLQALKQRVAGRPRLAAYLASPRRVPFNENGIFRHYPELDDPA