Protein Info for LRK54_RS06705 in Rhodanobacter denitrificans FW104-10B01

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 121 to 138 (18 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 43 to 186 (144 residues), 34.7 bits, see alignment E=5.6e-12 PF13439: Glyco_transf_4" amino acids 44 to 191 (148 residues), 61.2 bits, see alignment E=3.2e-20 PF00534: Glycos_transf_1" amino acids 202 to 352 (151 residues), 91.7 bits, see alignment E=1e-29 PF13692: Glyco_trans_1_4" amino acids 215 to 352 (138 residues), 98 bits, see alignment E=1.5e-31 PF13524: Glyco_trans_1_2" amino acids 302 to 383 (82 residues), 25.8 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: None (inferred from 62% identity to xal:XALc_2294)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>LRK54_RS06705 glycosyltransferase family 4 protein (Rhodanobacter denitrificans FW104-10B01)
MATAAGAGGTPPPAAAVRPAGAVALRGPPRVKLLFVGTNPENTGAASHFVALAQAMAAAG
HQVGAVVYPDGLIWQGLSQSEVRRYGARFRNVFDLRGYVAVIKAARQLKPDWLVGNFGKE
YWPLILIGRLLRIPVALFRHRTPPMKRISAWLIPRLAQRFLAVSQHARQAYLDRGVPGSL
VRVLYNPVNTAQCRRDPRQRRAILHSLGLDEDAIVLGYSGRMHRGKGIFPLFEAASAAMA
EQPRLHCLWLGDGPDAPALRALAAADVTAGRHHFLGWINDIHPYYSALSMLAFPSIATET
FGRVSVEAQAAGVPVLGSDLGGIPETLQTGVTGLLLPPGDVAAWREAILKLCDPALLASM
GAAAHDYVEQHFSMRVIASRFLQILTGG