Protein Info for LRK54_RS06685 in Rhodanobacter denitrificans FW104-10B01

Annotation: TolC family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 22 to 432 (411 residues), 328.1 bits, see alignment E=4.2e-102 PF02321: OEP" amino acids 24 to 206 (183 residues), 90.3 bits, see alignment E=7.3e-30 amino acids 230 to 418 (189 residues), 120.9 bits, see alignment E=2.9e-39

Best Hits

KEGG orthology group: None (inferred from 42% identity to psu:Psesu_0430)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>LRK54_RS06685 TolC family outer membrane protein (Rhodanobacter denitrificans FW104-10B01)
MRLKLLTLALALAAISLPSHGEDLLDAYRDARANDPVLSRADATRLATAEGVDQARALLL
PQISASMSLNQTNGGNQIGHSRSRSINGTLSQTVLDFSKYANLKAAHSASDAQDELYQAA
AQELYGRVAAAYFGVLTSEDELTYAKANEDAFRQQYEQSDQRFKVGLSAITDVYQAKAYY
EAAKSQTIAAQNALNDAREALTQITGKPTGDLKKLRDDLPMQPPAPADQDSWVKQALETN
PNLLTQKYNVETAQHNISAARAGHLPTITAGVSYGKGAGWSDSNAGARYRDPASTTIGLT
LNVPIFSGGLTQSRVRQSIYQRDAATDALEAQRRQVVRDTLNYYRSVIAGIAQVESAKAS
VESGRKALEATRAGFEVGTQTMTNVLLAIQTLTSSESSYSQARHQFILNKLLLKQTAGTA
ELKDIETINALLQ