Protein Info for LRK54_RS06435 in Rhodanobacter denitrificans FW104-10B01

Annotation: substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12849: PBP_like_2
  • amino acids 51 to 268 (218 residues), 83.2 bits, E=2.6e-27
• PF01476: LysM
  • amino acids 402 to 443 (42 residues), 55.3 bits, 5e-19

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Protein Sequence (446 amino acids)

>LRK54_RS06435 substrate-binding domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MSVRLARLLSVALIGACLATPTFAKSKPKAHHASAPAKSSLVWRGDVATANGVVNEVAKA
WEKSGHGRIELQPFNTASGIDAVASGTADLAGSARGSDNSAQNANLTFTPVAWDALVIVT
QSSNPVRNLSLKQVHDIYYGRIHNWSEVGGNNAPIDVYAVASPGDGVEYSLRSLLFGRGN
QPVAAPRLYVNTRKLEEGIALNPNGLGVSTLASISGNPKLKAIPINGRPATAANIADGSY
PLFTPLYLVTNPRSPKAAQAQAFVDFMQTAPAEAALRKHAVLPYQDGAALVALDTSRRSR
ILAEVGARPVRGTPVSAPGATYAARAAIAPTSPDTVAARQAVERRRADEKDNARLSRIQG
SVSDVTVSSVTHANGSATTREQAAGKNFGEVDANASQTMTTYKVAKGDTLSTIAKRHSVE
VAQLREWNHLKNDQLKLGQVLRIRNR