Protein Info for LRK54_RS06110 in Rhodanobacter denitrificans FW104-10B01

Annotation: phage tail sheath subtilisin-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF04984: Phage_sheath_1" amino acids 241 to 414 (174 residues), 37.2 bits, see alignment E=2.8e-13 PF17482: Phage_sheath_1C" amino acids 423 to 525 (103 residues), 35.3 bits, see alignment E=9.8e-13

Best Hits

KEGG orthology group: K06907, (no description) (inferred from 63% identity to nde:NIDE2219)

Predicted SEED Role

"Phage tail sheath protein FI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>LRK54_RS06110 phage tail sheath subtilisin-like domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MPSALTYPGVYIEEIPSGVRTITGVATSITAFVGRAARGPIDADAESPVIINSYGDFERN
FGSLDPACPMGYAVRDFYLNGGAQAAIVRLYKGTDGKPAKAAIAIANLPLEAASAGSWGN
QLRVRIDGNVSADIATGFGLAVGDLFNLTVRDLASGTQESFLNLSVKESPRRVDRVLKAG
SSLLRVASSLVLPATAMPAAHLDADAGKTVWEQDKSSTGVAAAGQAVDSAALDDNAYLGS
ADAKTGIYALKKADLFNLLCIPPDVRGGNTSKSVYQNAMALCVERRALLIVDAPADWGSA
GAITPAVLAALGLAGTAARNAALYFPRVIESDPKRQGQLDTFVPCGIVAGVMARTDTQRG
VWKAPAGIDAALNGVQGLAATLNDAENGMLNPLGVNCLRSFPLVGPVLWGARTLRGADLL
ADEYKYVPVRRLALYIEESLFRGTQWVVFEPNDEPLWSQIRLNVGAFMQNLFRQGAFQGK
TPADAYFVKCDKETTTQNDINLGIVNIVVGFAPLKPAEFVVIQLQQMAGQIQT