Protein Info for LRK54_RS05460 in Rhodanobacter denitrificans FW104-10B01

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF00571: CBS" amino acids 16 to 59 (44 residues), 31.6 bits, see alignment E=8.7e-12 amino acids 72 to 126 (55 residues), 60.3 bits, see alignment E=9.3e-21

Best Hits

Swiss-Prot: 31% identical to YHCV_BACSU: CBS domain-containing protein YhcV (yhcV) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 58% identity to mep:MPQ_2349)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>LRK54_RS05460 CBS domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MSQVKHLLQGKGNAIYSIAPEAPVLDAIKHMAEHRIGALLVMRGEQLVGVMSERDYARKV
ILQGRSSSQTAVSDIMSGPPLTVSPDTDVFDCMRLCTDSRIRHLPVVHDGKVVGVISIGD
LVKAVIDAQAEQIEHLQRYITS