Protein Info for LRK54_RS05425 in Rhodanobacter denitrificans FW104-10B01

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02937: RNA polymerase sigma factor, sigma-70 family
  • amino acids 23 to 177 (155 residues), 85.3 bits, E=1.9e-28
• PF04542: Sigma70_r2
  • amino acids 28 to 95 (68 residues), 58.4 bits, E=7.5e-20
• PF08281: Sigma70_r4_2
  • amino acids 120 to 170 (51 residues), 59.4 bits, E=3.3e-20
• PF04545: Sigma70_r4
  • amino acids 126 to 175 (50 residues), 31.7 bits, E=1.3e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 36% identity to sth:STH845)

Predicted SEED Role

No annotation

Protein Sequence (181 amino acids)

>LRK54_RS05425 sigma-70 family RNA polymerase sigma factor (Rhodanobacter denitrificans FW104-10B01)
MSPASTRANDSDDVRAAAAGDRHAFQRLYRLHVGRVHGAVYRLAGYDHARAEDLTQDAFV
RAWQKLPGFRHESAFGTWLYRLAVNVALMDIRARGADPVSMLDDEHLPDTGETPFCVAER
EELERAIGSLPPRARAVLVLHDIEGWRHEEIGSELGMAIGTSKAQLHRARGLLRKLLGEC
S