Protein Info for LRK54_RS05385 in Rhodanobacter denitrificans FW104-10B01

Annotation: CPBP family intramembrane metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details PF02517: Rce1-like" amino acids 137 to 228 (92 residues), 73.8 bits, see alignment E=5.6e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>LRK54_RS05385 CPBP family intramembrane metalloprotease (Rhodanobacter denitrificans FW104-10B01)
MHEQAIAFTTPSAAPRWQRWLLFSPLARIVIFAAWFVGLMMLAQFGFHLLGWGKGTPAPQ
LAIAQFVARALVPLAAYLLLVKGVERRPLAELAPRRLLPQGLSGVLFGLLLFSAVVATLW
LLGSYRVTGSNPDAAWVNALLVVGLGAGIGEEIIARGVIFRIVEEGLGSWWALLISALFF
GAAHIANPGATLWSSAAIAIEAGLLFGMLYHVTRSLAACMGLHAAWNFAQGTVYGIPVSG
SDADGWLISTRSGPDWLSGGAFGAEASVVALVLCSLCTLGLLVVARRRGSIVPPVWRR