Protein Info for LRK54_RS05295 in Rhodanobacter denitrificans FW104-10B01

Annotation: YceI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF04264: YceI" amino acids 30 to 193 (164 residues), 110.1 bits, see alignment E=6.6e-36

Best Hits

KEGG orthology group: None (inferred from 62% identity to bmu:Bmul_2669)

Predicted SEED Role

"Protein yceI precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>LRK54_RS05295 YceI family protein (Rhodanobacter denitrificans FW104-10B01)
MPSTLRTAIHAFGLLALLSLAAANAAEVKYQLDPDHTYPSFEADHFGGLSVWRGKFNHSR
GTATLDKTAGSGTVEVVVDMKSADFGQDQLNEKAQGAELFDTAKYPQAVYKGRLASFVGG
KPTRVIGTLTLHGVTRPLTLKIDSFKCVPHPMLKREVCGADALATFQRDAFGMDAGKPYG
FSMAVTLRIQVEAIAEPSA