Protein Info for LRK54_RS05235 in Rhodanobacter denitrificans FW104-10B01

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 10 to 178 (169 residues), 113.3 bits, see alignment E=6e-37

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 48% identity to psu:Psesu_0764)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>LRK54_RS05235 cytochrome b (Rhodanobacter denitrificans FW104-10B01)
MSLRSNDRQWGSVAKFFHWIIALGILGNGLFGLLMDLARSPMQKINWLALHKSIGLTVLA
LALLRIAWRWADRRPPEAPMPRWQQLAARAAHGVLYVLIVLLPLSGWWFNSVTGKPLQWF
KLFNLPALVGKNDELRHLAHGVHEYLFWFLLLVLVAHVGGALRHHVFDHDNVLRRMLPFG
RLRERGPSEGDPS