Protein Info for LRK54_RS05045 in Rhodanobacter denitrificans FW104-10B01

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 178 to 197 (20 residues), see Phobius details PF05227: CHASE3" amino acids 33 to 167 (135 residues), 36 bits, see alignment E=9.4e-13 TIGR00229: PAS domain S-box protein" amino acids 221 to 338 (118 residues), 26.5 bits, see alignment E=2.9e-10 PF00512: HisKA" amino acids 361 to 426 (66 residues), 42.6 bits, see alignment E=7.4e-15 PF02518: HATPase_c" amino acids 468 to 580 (113 residues), 94.4 bits, see alignment E=9e-31

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (587 amino acids)

>LRK54_RS05045 ATP-binding protein (Rhodanobacter denitrificans FW104-10B01)
MRWRTVGLLLAMLIIVGLPYIVTLQGARDTEQATEWVVRSTEVKSLAYRIAYVVHDSEAA
TYRLLAGDVNDATRARAARVGQEVPPLLRQLRRMTRDNPDQQALMGSLASGVNGRVTLMK
QALERLRQGNPDGARQSLRDADDLFGMNAQIASIVQIEDGLLQQRQAAAAQQSRNGRIVL
SITALAQLLLLTIIVITSERQIGRRQLAETREGRAVLRSQLIFQAVREPIALFDENLNSL
LVNNAFSELYGMDLRQRSLPLVQIGEGAWSDGVLLQRLNDVLLRDRELWDYEVVQRTVDG
IDRHVVINARRLQQQDGGTPALLLTVSDVTTRALAEQQVNELNRQLEGKVAQISDVNREL
EAFSYSVSHDLRAPLRHIAGFARKLEQHLGDRIDEKSAHYIEVIAGSAQRMAVLIDDLLV
FSRLGRGALRLQAVDMQSLVDEARALAESGVSGRRIVWDVAPLPMVIGDENMLRTVWQNL
LGNAVKYTGHCEVARIAVSVRQGRNGDYEFTVSDNGAGFDMQYADKLFGVFQRLHRASEF
PGNGIGLANVRRIVARHGGRVWAEAEPGRGAHFHFSLPATDAAGTRT