Protein Info for LRK54_RS04865 in Rhodanobacter denitrificans FW104-10B01

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 23 to 96 (74 residues), 73 bits, see alignment E=5.9e-24 PF13525: YfiO" amino acids 147 to 267 (121 residues), 38.3 bits, see alignment E=4.4e-13 TIGR02795: tol-pal system protein YbgF" amino acids 148 to 264 (117 residues), 131.9 bits, see alignment E=8.8e-43 PF13432: TPR_16" amino acids 157 to 217 (61 residues), 34.8 bits, see alignment E=6.5e-12 amino acids 191 to 253 (63 residues), 24.4 bits, see alignment E=1.2e-08 PF07719: TPR_2" amino acids 184 to 216 (33 residues), 25.5 bits, see alignment 3.4e-09 PF13174: TPR_6" amino acids 186 to 217 (32 residues), 26.9 bits, see alignment 1.7e-09 amino acids 222 to 254 (33 residues), 31.7 bits, see alignment 5.2e-11

Best Hits

KEGG orthology group: None (inferred from 45% identity to xcc:XCC3016)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>LRK54_RS04865 tol-pal system protein YbgF (Rhodanobacter denitrificans FW104-10B01)
MAGAIASAMLFAFPAFAQDSRLSLADRVARLEQQAQNKDQSGTGLVNQMQQLQAQVQQLQ
GQVEELQHQLQTLDDKNKAQYTDLDARLGRLEGGRAGAAAASGSNPQAQAGNPAAAASVV
AAANPAAGRPAANAGSNTATAGDPAAAQTAYDVAFKAIRAGNYVEASREFRSFIQQYPNH
ALAPNAWYWLGESYYATTNYPVALESFQQLLSQFPQSDKAPDALLKVGYSQLELKQTAAA
KATLTQVASKYPGSKAASLAQERLQRLQLQSGN