Protein Info for LRK54_RS04860 in Rhodanobacter denitrificans FW104-10B01

Annotation: 7-carboxy-7-deazaguanine synthase QueE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR04349: putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE" amino acids 21 to 230 (210 residues), 367.8 bits, see alignment E=7.9e-115 PF04055: Radical_SAM" amino acids 47 to 120 (74 residues), 45.8 bits, see alignment E=4e-16

Best Hits

Swiss-Prot: 48% identical to QUEE_CHLTE: 7-carboxy-7-deazaguanine synthase (queE) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K10026, queuosine biosynthesis protein QueE (inferred from 72% identity to xop:PXO_01567)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>LRK54_RS04860 7-carboxy-7-deazaguanine synthase QueE (Rhodanobacter denitrificans FW104-10B01)
MSGDDARKASGTPAAAVAERLRITEIFHSIQGEADAIGWRTVFVRLTGCPLRCVWCDTEY
SFYGGNWHAIDDILAEVATHGAKHVCVTGGEPLAQKRCLILLRRLCDAGYEVSLETSGAL
DVSAVDPRVRKVMDLKAPGSGESARNLWSNLDHLLPHDQIKIVLASRADYEWARAVLAEH
ALADRCMVLFSSVWGKVEPRELAEWIIADKLPVRFQLQLHKLLWSDARGK