Protein Info for LRK54_RS04415 in Rhodanobacter denitrificans FW104-10B01

Annotation: FtsX-like permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 285 to 312 (28 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 34 to 259 (226 residues), 43.3 bits, see alignment E=5.3e-15 PF02687: FtsX" amino acids 292 to 400 (109 residues), 51 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 51% identity to sml:Smlt4103)

Predicted SEED Role

"ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>LRK54_RS04415 FtsX-like permease family protein (Rhodanobacter denitrificans FW104-10B01)
MELRPILSTLRRHKTTAALLILEIALTCAIVCNAVFMIGHRLQHMRMSTGIDEHALVQVQ
LAEIAPTPDIYARAREDLAVLKQVPGVQAVALTNQLPLQGSSSNASIKLDPAQRAPTLSV
GTYFGEDIPQTMGTRLVAGRNLRPDETTNADLVVKALASGNTKGLPAVTVITQELAQRLW
PGQNPLGKSIYVTDQVSVRVVGVLADLVRANAYNDATAHYSVVLPLFMGAGKDQSYVIRT
RPQDRATVLKVAVAALKKADPERVVTTQRSYDELRQKFFANDRAMAGVLVGVILALLTVT
ALGIVGLASFWVAQRRRTIGVRRALGATRADILRYFQTENFLLASIGIALGMLLAYGINL
FLMLHYELPRLPAIYFPIGAVTLWLIGQVAVLGPALRAAAVPPVVATRSV