Protein Info for LRK54_RS04370 in Rhodanobacter denitrificans FW104-10B01

Annotation: threonine/serine exporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details PF06738: ThrE" amino acids 23 to 267 (245 residues), 166.3 bits, see alignment E=8.5e-53 PF12821: ThrE_2" amino acids 293 to 417 (125 residues), 47.1 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: None (inferred from 44% identity to psu:Psesu_2436)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>LRK54_RS04370 threonine/serine exporter family protein (Rhodanobacter denitrificans FW104-10B01)
MSAGDAISPQQFATTAPATRIAFVLELARRLHQYGTSAPRLEMAIAGAAQRLGLSADVWS
SPTAIIISFADLAQGEEGVAQTTQVMRLAPGEVNLERLCQADDIADRAIAGELGLREGFR
RLRELGRPDTRREKIGSIASYGLSAASIAALFLHSSWVDLVVAGVIGAVIGCITLLAASR
PRLAVASDAICALVATTVAIVVSAFVVPLAIKSVVLASLIILVPGMSLTNAVREISSGHL
VSGMARMGGAMSTLLKLTFGTIAATQLCAAVGITARDFALPALPTWTDYPALLVAAIAFA
ILFRAARRDWPVVIVAVVVGYLATRWGGAISGSLPGAPVGVFLGGLLLGALANVYARFAH
RPGAVIREPGILLLVPGSVGFRSVSFLLERDATLSLDTGVLLVTLLVSLVAGLMFGDLLV
SPRRSL