Protein Info for LRK54_RS04280 in Rhodanobacter denitrificans FW104-10B01

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 7 to 195 (189 residues), 224.6 bits, see alignment E=5.5e-71 PF01243: Putative_PNPOx" amino acids 23 to 100 (78 residues), 72.8 bits, see alignment E=2.1e-24 PF10590: PNP_phzG_C" amino acids 155 to 195 (41 residues), 53.1 bits, see alignment 2.4e-18

Best Hits

Swiss-Prot: 55% identical to PDXH_XANCP: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 58% identity to rce:RC1_0584)

MetaCyc: 44% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>LRK54_RS04280 pyridoxamine 5'-phosphate oxidase (Rhodanobacter denitrificans FW104-10B01)
MLKFEILDTFQRLLEEARASGDREPTAMNLATVDGSGRVASRIVLLKGADERGFRFYTNY
QSDKGGQLEAHPQVALCFHWKQLREGVQVRVEGVARKLLAEESDAYFASRPRGSQIGAWA
SLQSQTLPDRDTFEQRVARYEQQFDGLEVSRPPHWGGFVVEPDMVEFWYGAEFRLHERVR
WDRHGQTWTSRMLYP