Protein Info for LRK54_RS04160 in Rhodanobacter denitrificans FW104-10B01

Annotation: 16S rRNA (uracil(1498)-N(3))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF20260: PUA_4" amino acids 22 to 67 (46 residues), 44.3 bits, see alignment 1.6e-15 TIGR00046: RNA methyltransferase, RsmE family" amino acids 23 to 241 (219 residues), 186.2 bits, see alignment E=3.1e-59 PF04452: Methyltrans_RNA" amino acids 74 to 238 (165 residues), 172.2 bits, see alignment E=6.9e-55

Best Hits

Swiss-Prot: 44% identical to RSME_HAEIN: Ribosomal RNA small subunit methyltransferase E (rsmE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 62% identity to smt:Smal_3082)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>LRK54_RS04160 16S rRNA (uracil(1498)-N(3))-methyltransferase (Rhodanobacter denitrificans FW104-10B01)
MRTIRIHVDQPLVVYAEPNLPPQAAEHVGRVLRMNPGDPLTLFNGDGHDYAAVILAVGKR
EVAVRVESKQALRNESPLALTLAQGVARGEKMDLIVQKATELGVARIVPLLTERSEVRLD
AARAEKRLAHWRAVVASACEQSGRARLPEVAPALPLAAWLGSLADDGTLRLALLPEADRS
PRQLQFGPAGGLLVVGPEGGLGERDVDALSAAGFEGLRLGPRILRTETAGLAALAALQAL
HGDG