Protein Info for LRK54_RS03725 in Rhodanobacter denitrificans FW104-10B01

Annotation: polyphosphate kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF03976: PPK2" amino acids 3 to 223 (221 residues), 295.4 bits, see alignment E=1.5e-92 TIGR03707: polyphosphate kinase 2" amino acids 3 to 223 (221 residues), 323.8 bits, see alignment E=3.2e-101

Best Hits

Swiss-Prot: 47% identical to PK21A_RUEPO: Polyphosphate:NDP phosphotransferase 1 (SPO0224) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: None (inferred from 58% identity to xcb:XC_3366)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>LRK54_RS03725 polyphosphate kinase 2 (Rhodanobacter denitrificans FW104-10B01)
MGKRYRNAMKELQLDLIRLQRGLRSSGKRLLVIFEGRDAAGKGGTIKAITESLDTRGYRI
AALGKPSETETTQWYFQRYVTHLPSAGEFVLFDRSWYNRAVVEPAMGFCSSTQYEAFLDA
VPAFEKLLADDGIILLKYWLAVDQAEQEQRFAERADDPLKRWKLSPVDRVARQKYAEMGR
LRDVMIERTHAEHAPWFVVDFNDQKRGRINLIRHLLQQVPLHEEAVPALKLPKLKGKPKT
EHVTDQALWVPATF