Protein Info for LRK54_RS03225 in Rhodanobacter denitrificans FW104-10B01

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF05198: IF3_N" amino acids 17 to 84 (68 residues), 107.6 bits, see alignment E=2.9e-35 TIGR00168: translation initiation factor IF-3" amino acids 17 to 179 (163 residues), 213.2 bits, see alignment E=8.7e-68 PF00707: IF3_C" amino acids 92 to 177 (86 residues), 119.6 bits, see alignment E=4.6e-39

Best Hits

Swiss-Prot: 75% identical to IF3_XANAC: Translation initiation factor IF-3 (infC) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 74% identity to smt:Smal_2804)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>LRK54_RS03225 translation initiation factor IF-3 (Rhodanobacter denitrificans FW104-10B01)
MEDRGIATTDNKGNRRNLEIRVPRVRVIGADSEQLGILSRDEALSLAQEAGMDLVEIQPN
GDPPVCRIMDYGKFKFEAQKKAQAAKKKQKQVEIKEVKFRPVTDVGDYQIKLRNMLRFLE
EGDKVKVTIRFRGREMSHQDLGQNLAKKIQEDVGDNGQVESFPRLEGRQMVMMIGPKKK