Protein Info for LRK54_RS03145 in Rhodanobacter denitrificans FW104-10B01

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details PF07730: HisKA_3" amino acids 194 to 260 (67 residues), 63.8 bits, see alignment E=1.8e-21 PF02518: HATPase_c" amino acids 293 to 379 (87 residues), 41.4 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K07778, two-component system, NarL family, sensor histidine kinase DesK [EC: 2.7.13.3] (inferred from 52% identity to xac:XAC3994)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>LRK54_RS03145 sensor histidine kinase (Rhodanobacter denitrificans FW104-10B01)
MIPAFIARWFVPAPDSAVADDLRRGKSPWADSVHLLWSLWIFITPLFDHGLRGYTSTWLL
CTLGSYPLFLLLFARLRLASRRTAHRYAWGMAVLCFGLLRWYPSGLSYFVYACVMLSHCE
LRHFRSYVIQVVLLNVVYVALAWWIGYPQALLVIMPVTVFVICTIVTVEQIHQEKDAALS
LSHDEVRRLAATAERERIGRDLHDLLGHTLSLITLKLELSRKLFDRDVDAARREVEEAEK
VARHALAEVRCAVTGIRATDLAAELASARLLLESSRVHLDYGELPADLPGEIERGLSLVL
REAVTNIARHADASQARIELARERNSVCLRISDNGRGGIESDGNGLSGMRERVRALGGTL
AFESPRGQGSRLRVVVPLPIVRLVESSRSAPDPSMAGPLTQPVTDRPVA