Protein Info for LRK54_RS03130 in Rhodanobacter denitrificans FW104-10B01

Annotation: tRNA guanosine(34) transglycosylase Tgt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR00449: tRNA-guanine family transglycosylase" amino acids 6 to 369 (364 residues), 509.2 bits, see alignment E=5.9e-157 TIGR00430: tRNA-guanine transglycosylase" amino acids 6 to 369 (364 residues), 535 bits, see alignment E=9.1e-165 PF01702: TGT" amino acids 13 to 370 (358 residues), 531.5 bits, see alignment E=5.2e-164

Best Hits

Swiss-Prot: 71% identical to TGT_XANAC: Queuine tRNA-ribosyltransferase (tgt) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 72% identity to psu:Psesu_1871)

MetaCyc: 66% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>LRK54_RS03130 tRNA guanosine(34) transglycosylase Tgt (Rhodanobacter denitrificans FW104-10B01)
MTSLQFELHATDGAARRGRLGFARGTVETPAFMPVGTYGSVKAMTPRDLVETGAEIILGN
TFHLFLRPGLEVIEPFGGLHKFIGWDKPILTDSGGFQVFSLAHKRKITEEGVTFASPVDG
SKVFLSPEVSMRIQKTLDSDIAMIFDECTPYPATEKVAADSMELSLRWAERSRRAFDDLK
NPNSLFGIVQGSVYETLRRRSAEGLVKLGFDGYAIGGLAVGEPEAERNHALDFTVPLLPA
DRPRYLMGVGRPEDIVEAVRRGIDMFDCVMPTRNARNGFLFTAAGTLRIRNAKYASDTAV
IEEGCDCYACSHGFSRAYLRHLDRCNEILGSQLATMHNLRYYQRLMTGLRQAIADHALEA
FVAEFYARRQGAAVS