Protein Info for LRK54_RS03015 in Rhodanobacter denitrificans FW104-10B01

Annotation: beta-ketoacyl-[acyl-carrier-protein] synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 389 to 404 (16 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 7 to 245 (239 residues), 175.1 bits, see alignment E=3.1e-55 PF02801: Ketoacyl-synt_C" amino acids 253 to 365 (113 residues), 119.2 bits, see alignment E=1.5e-38

Best Hits

Swiss-Prot: 52% identical to NODE_RHIME: Nodulation protein E (nodE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K14660, nodulation protein E [EC: 2.3.1.-] (inferred from 62% identity to xal:XALc_1783)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.179

Use Curated BLAST to search for 2.3.1.- or 2.3.1.179

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>LRK54_RS03015 beta-ketoacyl-[acyl-carrier-protein] synthase family protein (Rhodanobacter denitrificans FW104-10B01)
MPTVSTRRVVITGMGAISPLGVGAAALWQGLREGRSAIGPLRHPDAERLRVKVAAQVPES
FDPAAHIDERTLPLLDRTSEFALHAAREAVAQSGVDFAGGLGLRTAVIVGTGVGGETTQD
EQSRRLYAENAQRAHPLTIVRLMTNASASQISIAYGLHGPTYAVASACASANHAIIQAAQ
MIRYGMADAAVTGGTEACLTYGALRAWEAMRVVADDTCRPFSANRRGLVLGEGAGIFVLE
SLEHAQARGATILAELAGTGMSADASDIVMPSAEGAATAMRLALAEAELNPQDVDYINAH
GTGTQANDVTETRAIRLAFGAYADRLAVSSTKSMHGHALGASGALELVAAIGALRENVVP
PTANLNQVDPACDLDYVPNVAREMPVRAVLSNSFAFGGLNAVLALKRAS