Protein Info for LRK54_RS02990 in Rhodanobacter denitrificans FW104-10B01

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details PF01041: DegT_DnrJ_EryC1" amino acids 31 to 199 (169 residues), 116.5 bits, see alignment E=8.3e-38 amino acids 271 to 397 (127 residues), 22.5 bits, see alignment E=3.1e-09

Best Hits

KEGG orthology group: None (inferred from 59% identity to aaa:Acav_4233)

Predicted SEED Role

"DegT/DnrJ/EryC1/StrS aminotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>LRK54_RS02990 DegT/DnrJ/EryC1/StrS family aminotransferase (Rhodanobacter denitrificans FW104-10B01)
MLLRRRHELPPTAGLPLGLADLRPGAPTLADDIAALLGTPPLQLTCSGTAALLLTLATLR
ELAPRRRRVVVPAYTCPLVAIAVRQAGLELQLCDLRPGHYDMDPSALRAACDERTLAIVP
THLAGRVADVDDALAVARQVGAYVIEDAAQALGARRADGTSVGLAGDAGFFSLAAGKGLS
IYEGGLLAARDPVLRERLARAAAGVPQRPGWEWRRRLELLGYAALYRPWGLRLAYGAPLR
RALRRGDEIAAVGDDFPPTIPLHRVGRWRQAVGSHAVPRLPAFLAQLSAQAQRRLPRLRQ
IGGIDVLDDPAGACGTWPFFLLLLPDRRRRDAALAQLWPAGYGASRLFIHALPDYPYLAD
VVPAADVPHARDFAARSLSLGNSPWLTDADFETICGVLGNG