Protein Info for LRK54_RS02790 in Rhodanobacter denitrificans FW104-10B01

Annotation: MlaD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details PF02470: MlaD" amino acids 54 to 133 (80 residues), 47.2 bits, see alignment E=1.1e-16 amino acids 169 to 229 (61 residues), 42.2 bits, see alignment E=3.9e-15 amino acids 299 to 405 (107 residues), 43.4 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 61% identity to pfl:PFL_4554)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>LRK54_RS02790 MlaD family protein (Rhodanobacter denitrificans FW104-10B01)
MTDDNPIEQAPPGGELPRPVVKRRRFNASLIWLVPALAALVGLSLVINNWLQAGPQITIS
FQSAEGLDAGKTPVKYKNVVIGRVNKIHLSSDRSHVLVNVALEKSAEGFATKDTRFWVVR
PRIGLGGVSGIDTLLSGAFIGADVGDSNDYQDEFKGLELPPAVNHGAPGRSFVLHSGDLG
SLDIGSPVYYRRIQVGRVASYQLDPDGKGVSLQIFVDGPNDKFVTRSSRFWNASGVDVSI
GANGLKLNTQSLATVLAGGVAFQDPPGPHDSTPAPEDNAYTLFGDQATAMAPPDGTPHYI
RMRFEQSVRGLAVDAPVEFLGINIGKVVSVRLDYDEQKQRFPVLVGAVIYPQRLGAAYDK
LEALAKAHGENPDLSQMIGRLVEHGLRAQARTGNLLTGQLYVALDFIPKTPKVAFDPAAK
PLTIPTVPGSFDKLQEQMAGIVDKLAKVPFDSIGQNLDRSLAGLDRTLKQVNGQTLPALG
DTLHGVQRTMGTANEALAGDSPLQQNLGATLEQLQRMARSLRVLTDYLGGHPEALIRGRR
ADAKPADAKPVTTPAAMPPTQGSKP