Protein Info for LRK54_RS02680 in Rhodanobacter denitrificans FW104-10B01

Annotation: CPBP family intramembrane metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 33 to 59 (27 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF02517: Rce1-like" amino acids 171 to 262 (92 residues), 79.1 bits, see alignment E=1.3e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>LRK54_RS02680 CPBP family intramembrane metalloprotease (Rhodanobacter denitrificans FW104-10B01)
MQISSTEVSPLSPPDSPPPPHAGRTAPGLRASVGIIVVYFALQFAVSFLFGAAIAATAAL
RNNGAGIETAIRTTLAQPAMQALLAILSLGVAAPLTLWLMRRSWPALWPQAQPPGFGFVR
PRQPLFFALAVLVGLAAPFLGALLTEWLAHGHTVTQDIQQIGGNTPLGLRIPLVLVVVCV
GPLVEELLFRGVLLSALMKRVHVGWAVAGSSLLFALVHLPGLDYQWYALPNLLLLALLLA
GLRLRSGSIWPAVLAHGVNNLLAVAVWFVAINPPG