Protein Info for LRK54_RS02330 in Rhodanobacter denitrificans FW104-10B01

Annotation: elongation factor P-like protein YeiP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08207: EFP_N
  • amino acids 2 to 60 (59 residues), 42.6 bits, E=7.5e-15
• PF01132: EFP
  • amino acids 70 to 123 (54 residues), 49.4 bits, E=5.4e-17
• PF09285: Elong-fact-P_C
  • amino acids 131 to 186 (56 residues), 72.8 bits, E=2.2e-24

Best Hits

Swiss-Prot: 64% identical to EFPL_STRMK: Elongation factor P-like protein (Smlt2205) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K02356, elongation factor P (inferred from 64% identity to xal:XALc_1330)

Predicted SEED Role

"Translation elongation factor P-related protein"

Protein Sequence (187 amino acids)

>LRK54_RS02330 elongation factor P-like protein YeiP (Rhodanobacter denitrificans FW104-10B01)
MKASDVKKGNVVEHDGTVYQVRDIERSSPSARGGNVTFRFTLYSIPGGRKFDLSLRADDE
LREMDLVRRAANFSYMDDGAFVFMDAEDYTQYPLSPELVGDNAGYIVEGVEGYYVQLIDD
VPVGLQVPTSVVLTVVDTAPEMKGSSATKRTKPAKLDTGIEIQVPEYISNDEKVWVNTLT
GEFAGRA