Protein Info for LRK54_RS01845 in Rhodanobacter denitrificans FW104-10B01

Annotation: RnfABCDGE type electron transport complex subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 6 to 148 (143 residues), 212.7 bits, see alignment E=1.7e-67 PF04060: FeS" amino acids 15 to 47 (33 residues), 58.2 bits, see alignment 2.1e-19 PF14697: Fer4_21" amino acids 80 to 133 (54 residues), 62.1 bits, see alignment E=1.8e-20 PF00037: Fer4" amino acids 82 to 102 (21 residues), 25.8 bits, see alignment (E = 2.9e-09) amino acids 112 to 132 (21 residues), 25.6 bits, see alignment (E = 3.1e-09) PF13237: Fer4_10" amino acids 82 to 128 (47 residues), 27.2 bits, see alignment 1.3e-09 PF12838: Fer4_7" amino acids 87 to 131 (45 residues), 29.7 bits, see alignment 2.9e-10 PF13187: Fer4_9" amino acids 87 to 132 (46 residues), 29.2 bits, see alignment 3e-10

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 59% identity to bpt:Bpet1726)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>LRK54_RS01845 RnfABCDGE type electron transport complex subunit B (Rhodanobacter denitrificans FW104-10B01)
MTELVTLADRIDAVLPQTQCEQCGYHGCRPYAEAIARGEADINRCPPGGDAGIAKLAALL
QRPVLPLDLACGTEKPRMLARIVEADCIGCTKCIQACPVDAIVGASKLMHTVLADDCTGC
ELCVPACPVDCIVLEPMPPAQIDQAHADAAREHFRRREARLAREAAEREAELAARKAAVD
TLAAANPVLAALARAKAKRQEPNP