Protein Info for LRK54_RS01325 in Rhodanobacter denitrificans FW104-10B01

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00156: Pribosyltran" amino acids 39 to 204 (166 residues), 66 bits, see alignment E=4.9e-22 PF20408: Abhydrolase_11" amino acids 271 to 436 (166 residues), 35.4 bits, see alignment E=1.9e-12 PF00561: Abhydrolase_1" amino acids 272 to 394 (123 residues), 30.9 bits, see alignment E=4.5e-11

Best Hits

Swiss-Prot: 52% identical to Y0571_MYCTO: Putative phosphoribosyl transferase MT0597 (MT0597) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K07100, (no description) (inferred from 52% identity to mra:MRA_0578)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>LRK54_RS01325 alpha/beta fold hydrolase (Rhodanobacter denitrificans FW104-10B01)
MAHSTPQARWLPPVPCGAALECIPMVSLPFLDRDDAGRQLADALAHYRGAQPVVLAIPRG
AVPMGLVVADALGGELDVVLVRKLGAPGNPEFAIGAVDEHGSVLLNEYAAEAGADTAYTR
RVAQRELALIRERRARYRPGRPATVLAGRTVIVVDDGLATGATMVAALRAVRAQGPARLV
CAVPVAAADSLARVSALADEVVCLATPRPFPAVGSHYLDFDSVSDEQVIALLADPVAAEA
PASPSPGGPVHIPAEQVVLEGDLVSPPSPRGLVLFVHGSGSSRHSTRNRYVASVLNRRGF
STLLFDLLTPQEDRDTAARFDVPRLARRLDAALQWAQRQAALRDLPRGLFGASTGAAAAL
MVAAARPGEIDAVVSRGGRPDLADTSSLSRVQAPTLLIVGGADLQVLELNRAAQAAMPQG
ASLTVVPGATHLFEEPGALEQVAAIAADWFARWL