Protein Info for LRK54_RS01245 in Rhodanobacter denitrificans FW104-10B01

Annotation: histidine triad nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 4 to 105 (102 residues), 84 bits, E=1.1e-27
• PF01230: HIT
  • amino acids 11 to 108 (98 residues), 96.1 bits, E=1.7e-31

Best Hits

Swiss-Prot: 67% identical to Y1390_SYNE7: Uncharacterized HIT-like protein Synpcc7942_1390 (Synpcc7942_1390) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 66% identity to hna:Hneap_1569)

MetaCyc: 54% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

No annotation

Protein Sequence (114 amino acids)

>LRK54_RS01245 histidine triad nucleotide-binding protein (Rhodanobacter denitrificans FW104-10B01)
MTDTIFSKIVRREIPADIVYEDDEVLAFRDLNPQAPVHLLFIPKQPLATLDDATEGDAEL
LGKLLLAAAAYAKREGFAGQGYRTVINCNEDGGQTVYHLHVHLLAGRRMHWPPG