Protein Info for LRK54_RS01095 in Rhodanobacter denitrificans FW104-10B01

Annotation: NADH-quinone oxidoreductase subunit NuoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 16 to 326 (311 residues), 412.5 bits, E=5.6e-128

Best Hits

Swiss-Prot: 67% identical to NUOH_CHRVO: NADH-quinone oxidoreductase subunit H (nuoH) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 67% identity to cvi:CV_0948)

MetaCyc: 56% identical to MbhM (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• Fe(II) oxidation (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Protein Sequence (342 amino acids)

>LRK54_RS01095 NADH-quinone oxidoreductase subunit NuoH (Rhodanobacter denitrificans FW104-10B01)
MLDQLIHQLVVPILYILAIVLPLVLAVAMFVYWERKVLGWMHVRMGPNKIGPFGLLQALA
DVVKLLIKEVILPTKANRFLYYTAPMIALIPALAVWAVVPFSSTMVLSNANAGVLYLLAM
TSMGVYGIIIAGWASNSRYALLGAMRSAAQVISYELAMGLCLVCVLVLAGSLNLSAIVNA
QAGSKGVLDWFWLPLLPVFVVYFISGVAETNRAPFDVAEGESEIVAGFHVEYSGSAFALF
FLAEYANMILLSFLAAVLFMGGWLSPFPASWGFLGQGGFPWLLLKAFLLSFMFLWFRATF
PRYRYDQIMRLGWKVFIPIAIAWVFVAGCLKYWGLVSIGTGA