Protein Info for LRK54_RS01010 in Rhodanobacter denitrificans FW104-10B01

Annotation: S-methyl-5-thioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 12 to 326 (315 residues), 441 bits, E=2.5e-136
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 38 to 326 (289 residues), 364.4 bits, E=4.3e-113
• PF01008: IF-2B
  • amino acids 53 to 326 (274 residues), 260.8 bits, E=7.2e-82

Best Hits

Swiss-Prot: 70% identical to MTNA_XANOP: Methylthioribose-1-phosphate isomerase (mtnA) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 71% identity to psu:Psesu_1731)

MetaCyc: 50% identical to 5-methylthioribose-1-phosphate isomerase monomer (Klebsiella pneumoniae)
S-methyl-5-thioribose-1-phosphate isomerase. [EC: 5.3.1.23]

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• L-methionine salvage cycle III (10/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (9/12 steps found)
• 5'-deoxyadenosine degradation I (2/3 steps found)
• L-methionine salvage cycle II (plants) (7/11 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Protein Sequence (339 amino acids)

>LRK54_RS01010 S-methyl-5-thioribose-1-phosphate isomerase (Rhodanobacter denitrificans FW104-10B01)
MIIAAETHDSIRAVQWQGDHLRLLDQRLLPGEERWIDCRDAAQVTQAIRDLAVRGAPAIG
IAAAWGVAMAAQQGAPLEPVLAMLRAARPTAVNLMWALDRMKKRIAAGADAGALLREAQA
IQNEDLAANRRMGELGAALISTGSGVLTHCNTGSLATAGYGTALGVIRAGVAAGRIARVY
AGETRPWQQGARLTMWELVRDGIPAQLIADSAAAHLMKSGAVQWVIVGADRIAANGDTAN
KIGTYQLAIAAKYHGVKFMVVAPSSTVDMATGSGEEIEIELRDPAELLSTGGRRTVVEGA
QAWNPVFDVAPAELIDAIVTERGVIERPNSIAMQAMFGC