Protein Info for LRK54_RS00920 in Rhodanobacter denitrificans FW104-10B01

Annotation: phosphoadenylyl-sulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02057: phosphoadenosine phosphosulfate reductase
  • amino acids 16 to 237 (222 residues), 272 bits, E=4.7e-85
• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 28 to 237 (210 residues), 256.5 bits, E=2.3e-80
• PF01507: PAPS_reduct
  • amino acids 43 to 214 (172 residues), 182.1 bits, E=5.1e-58

Best Hits

Swiss-Prot: 68% identical to CYSH_XANCP: Phosphoadenosine phosphosulfate reductase (cysH) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 69% identity to psu:Psesu_0465)

MetaCyc: 67% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Protein Sequence (240 amino acids)

>LRK54_RS00920 phosphoadenylyl-sulfate reductase (Rhodanobacter denitrificans FW104-10B01)
MSAALLEQAPHEPRALAELNAVLSRLDAERRVAWALEHVAGEHVLSSSFGAQSAVSLHLV
TRRRPDIPVVLIDTGYLFPETYRFVDELTERLGLNLKVYSAPLSPAWMEARHGRLWEQGV
AGLDHYNRLRKVEPMQRALADLHAVGWFAGLRRGQSRSRAAIEFAGIRNGRWKFHPLADW
SDRDIGQYLARHGLPYHPLWQQGYVSIGDSHTSRRWEPGMDVEDTRFFGLKRECGLHSLA