Protein Info for LRK54_RS00840 in Rhodanobacter denitrificans FW104-10B01
Annotation: FMN-dependent NADH-azoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to AZOR_METSB: FMN-dependent NADH-azoreductase (azoR) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 59% identity to msl:Msil_0447)Predicted SEED Role
"FMN-dependent NADH-azoreductase"
Isozymes
Compare fitness of predicted isozymes for: 1.7.-.-
Use Curated BLAST to search for 1.7.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (194 amino acids)
>LRK54_RS00840 FMN-dependent NADH-azoreductase (Rhodanobacter denitrificans FW104-10B01) MKLLHIDSSALGGYSVSRQLTADIVAELKRSTPDANLHYHDLAAQPLPHWTPVADASDPA AVLGNQLLEEFLAADVVVIGAPMYNFAISSSLKAWLDRILVAGKTFRYTANGPEGLAGGK RVIVASSRGGIYSKDSAAAAMDFQEPYLRAAFAFIGIDDVEFVRAEGMAIGDEQKAAALK SAHGMIETLVAKAA