Protein Info for LRK54_RS00650 in Rhodanobacter denitrificans FW104-10B01

Annotation: L-threonine 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR00692: L-threonine 3-dehydrogenase" amino acids 7 to 343 (337 residues), 504.3 bits, see alignment E=7.8e-156 PF08240: ADH_N" amino acids 28 to 141 (114 residues), 115.1 bits, see alignment E=2.7e-37 PF16912: Glu_dehyd_C" amino acids 163 to 329 (167 residues), 37.1 bits, see alignment E=3.6e-13 PF00107: ADH_zinc_N" amino acids 178 to 305 (128 residues), 103.5 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 87% identical to TDH_STRMK: L-threonine 3-dehydrogenase (tdh) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00060, threonine 3-dehydrogenase [EC: 1.1.1.103] (inferred from 88% identity to smt:Smal_0806)

MetaCyc: 65% identical to threonine dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-threonine 3-dehydrogenase. [EC: 1.1.1.103]

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>LRK54_RS00650 L-threonine 3-dehydrogenase (Rhodanobacter denitrificans FW104-10B01)
MPQTMKALVKRKPEQGIWMEEVPLPEVGPNEVLIKIEKTAICGTDLHIYKWDEWSQRTIK
PGLTIGHEFVGRIVEVGPGVTGYKVGDRVSAEGHIVCGHCRNCRAGRQHLCPNTVGIGVN
RNGAFAEYMTMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFDLIGEDVLITGAGPIG
IIAAGIAKHVGARNVVVTDVNDYRLKLAADMGATRVVNVANQSLKDVMKDLHMEGFDVGL
EMSGNPRAFNDMLDCMYHGGKIALLGIQPKGAGIDWDKVIFKGLTLQGIYGRKMYETWYK
MTQMVLTGFPLQKVLTHQIHIDDFQKGFDLMDAGKCGKVVCSWS