Protein Info for LRK54_RS00530 in Rhodanobacter denitrificans FW104-10B01

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 TIGR00229: PAS domain S-box protein" amino acids 12 to 136 (125 residues), 44.1 bits, see alignment E=2.1e-15 PF08447: PAS_3" amino acids 38 to 123 (86 residues), 53.9 bits, see alignment E=1.8e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 144 to 310 (167 residues), 174.4 bits, see alignment E=1.6e-55 PF00990: GGDEF" amino acids 148 to 308 (161 residues), 166.5 bits, see alignment E=4.3e-53

Best Hits

KEGG orthology group: None (inferred from 72% identity to mep:MPQ_2668)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>LRK54_RS00530 sensor domain-containing diguanylate cyclase (Rhodanobacter denitrificans FW104-10B01)
MVAIENRLESDSAVYKTLLESTRAIPWKIDWDSKQFAYIGPQIEALLGWAPSSWESVGDW
ASRMHPEDRDWVVDFCVAQSQAGVDHEADYRALTRDGHYVWIRDVVHVVRRPDGTVDSLI
GFMFDISERKRTEQQLVSLQKEMEELSFRDGLTGVANRRRFDAVIELEWSNARRNRQPLS
LLMIDIDYFKQYNDRYGHLEGDACLKHVARVLGSAATRARDLPARFGGEEFVLVLPETDQ
AAARKLAERCRELILAEQIPHEWSPIGPILTISVGVGSAIPGHDDELRAFIDMVDKRLYQ
AKQQGRNRIVAG