Protein Info for LRK54_RS00435 in Rhodanobacter denitrificans FW104-10B01

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF03054: tRNA_Me_trans" amino acids 1 to 196 (196 residues), 255.6 bits, see alignment E=6.6e-80 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 1 to 353 (353 residues), 424.7 bits, see alignment E=1.2e-131 PF02540: NAD_synthase" amino acids 2 to 67 (66 residues), 23.9 bits, see alignment E=4.2e-09 PF20259: tRNA_Me_trans_M" amino acids 202 to 269 (68 residues), 72.7 bits, see alignment E=2.8e-24 PF20258: tRNA_Me_trans_C" amino acids 279 to 353 (75 residues), 83.4 bits, see alignment E=2.4e-27

Best Hits

Swiss-Prot: 67% identical to MNMA_STRM5: tRNA-specific 2-thiouridylase MnmA (mnmA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 67% identity to smt:Smal_1919)

MetaCyc: 61% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>LRK54_RS00435 tRNA 2-thiouridine(34) synthase MnmA (Rhodanobacter denitrificans FW104-10B01)
MKVMLGISGGVDSSVAALLLQQAGYEVEGLFMQNWEEDDRAGPCTADADRKDAVAVCGRL
GIPFHARNFAAEYWDGVFAHFLAEYRAGRTPNPDVLCNREIKFKTFLDEARTLGAEKIAT
GHYARIDCKDGHYRLLRAVDAAKDQSYFLHALGQQQLAATLFPLGGIEKSRVREIARAAT
LPTHAKKDSTGICFIGERDFRGFLAQYIPACPGEMRTPDGELIGEHQGAMYYTLGQRNGL
GIGGRHGASGEAWYVVGKDVTANVLYVAQGGENHWLYSRRLRSEPPSWIAGAAPATRFRC
TARTRYRQADQACAVVVTDDGLEVRFDEPQRAVTPGQSVVLYDGEVCLGGAVIAATDAPY
GGLLPASTPFPMSPAGEPQARV