Protein Info for JOY50_RS00735 in Pseudomonas sp. BP01

Annotation: ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08545: ACP_syn_III
  • amino acids 108 to 185 (78 residues), 71.6 bits, E=4.2e-24
• PF08541: ACP_syn_III_C
  • amino acids 221 to 306 (86 residues), 75.8 bits, E=2.4e-25

Best Hits

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 99% identity to ppu:PP_4379)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Protein Sequence (309 amino acids)

>JOY50_RS00735 ketoacyl-ACP synthase III (Pseudomonas sp. BP01)
MIGIKSIASYVPTAGLDNYVQGAKFGKDEEFMFGKIGASFLPRKAEEQETSDLCVEAAQA
LFASNPDLDPQSIDALIVVTQNGDEEGLPHTAAIVQSKLGLSTRVAAFDVSLGCSGYVYG
LYAIKGFMEAAGLKNGLLITADPYSKIVDPEDRNTTMLFGDAATATWMGEDAVWNLGQAR
FGTDGSGAEHLKVTDGKFFMNGRQVFNFALVKVPAHLHELLDASGLKSSDIDAFCIHQGS
AAIVDAVARRFEEQHPEKFVKDMLETGNTVSSSVPLLLQKHMLDGSWKRVAISGFGVGLS
WGSAILYRD