Protein Info for IKLFDK_29650 in Pseudomonas aeruginosa PA14

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF12625: Arabinose_bd" amino acids 22 to 199 (178 residues), 145 bits, see alignment E=4.3e-46 PF12833: HTH_18" amino acids 250 to 327 (78 residues), 70.1 bits, see alignment E=2.5e-23 PF00165: HTH_AraC" amino acids 289 to 326 (38 residues), 27.2 bits, see alignment 5.2e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to pap:PSPA7_5509)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>IKLFDK_29650 AraC family transcriptional regulator (Pseudomonas aeruginosa PA14)
MRDLTDDVALMRPVIDALRASGCDPDRVLVRVGLPPGGLPAGRFPHSAQNLFWKAAADEC
GEEHVGLHLAEHLPAFHGLLLEYLFLSSDTFGAGLRHSLRYVRLLSDTLQAQLEVEGERA
VLSLGESPAINRHFPEMLAGAVIRLFGALTEGEFKPLEVQLMNETGAPMERYRAVYGCPT
ILGMPRYALVFDAAVLDKPSRHAAPELLRMHESLARRQLAEVERLDLVRQVRELIGELLV
DGGATLEQVAARLGMPARRLRERLAMAGVRFNDLVTDYRCRLAKELLLKTDERIEVIVER
TGFSEPSTFYRAFKRWVGETPVEFRRRGQQGRG