Protein Info for IKLFDK_17090 in Pseudomonas aeruginosa PA14

Annotation: Uncharacterized PhzA/B-like protein PA3332

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 5 to 322 (318 residues), 329.4 bits, E=1.1e-102
• PF08545: ACP_syn_III
  • amino acids 105 to 185 (81 residues), 88.2 bits, E=2.8e-29
• PF08541: ACP_syn_III_C
  • amino acids 233 to 322 (90 residues), 112.7 bits, E=7.4e-37

Best Hits

Swiss-Prot: 100% identical to FABH_PSEA8: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to pau:PA14_20950)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Protein Sequence (330 amino acids)

>IKLFDK_17090 Uncharacterized PhzA/B-like protein PA3332 (Pseudomonas aeruginosa PA14)
MPRAAVVCGLGSYLPEAVLSNDMLAAELDTSDAWISSRTGVRQRHIAGDLGSGDLALRAA
SAALASAGLERVDAVVLATSTGDFCCPATAPRVAARLGLVGALAFDLSAACTGFVYGLAS
VGSLISAGLADSALLVGVDTFSHTLDPADRSTRALFGDGAGAVVLRAGDAEEEGALLAFD
LGSDGHQFDLLMTPAVSRAERSSGQASNYFRMDGKAVFGQAVTQMSDSVRRVLDRVGWQA
SDLHHLVPHQANTRILAAVADQLDLPVERVVSNIAEVGNTVAASIPLALAHGLRQGILRD
GGNMVLTGFGAGLTWGSVALRWPKIVPTMD