Protein Info for IKLFDK_16375 in Pseudomonas aeruginosa PA14

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details PF00892: EamA" amino acids 9 to 135 (127 residues), 55.8 bits, see alignment E=3.1e-19 amino acids 147 to 277 (131 residues), 79.7 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to pau:PA14_22560)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>IKLFDK_16375 EamA family transporter (Pseudomonas aeruginosa PA14)
MNRRSALAALHGGALLFGLTGVFGKLASASPGVIVFGRALFAVLALGLFARLAGQAWRAL
GPAQWLRLALCGLLLAGHWVSFFIAVKTAGVAIATLGFASFPAFTVILEGLLFRERIHLA
EGLLVVLVSLGLVLVTPNFDLASGATLGLLWAILSGLLFALLSLANRSNSGQVGPVQAAL
WQNLVVALCLLPFAVGELPALPALDWLWLALLGVFCTGLAHSLFVASLAVVKARTAALVF
SLEPVYGIAFAWLLFHETPGPRMFLGGALIVLAIVLSARLGARNRPVPDNGLSANRG