Protein Info for IAI47_21875 in Pantoea sp. MT58

Annotation: ParB/RepB/Spo0J family partition protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 61 to 216 (156 residues), 94.5 bits, see alignment E=3.3e-31 PF02195: ParBc" amino acids 62 to 134 (73 residues), 32.4 bits, see alignment E=8.3e-12 PF08775: ParB" amino acids 193 to 320 (128 residues), 104.3 bits, see alignment E=6.7e-34

Best Hits

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_pPag10157)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>IAI47_21875 ParB/RepB/Spo0J family partition protein (Pantoea sp. MT58)
MSKPIQRIGRKFGDSAIANMIDSSSQSRTFTLKSGAKATFVRQLILHDDIETRTTVDPQI
NGRDQSTLTPESLQEITRTITLQQFFPAIGRINGDQIEIMDGSRRRAACILSGASLEVLV
TADELSISDARQLAADIQTAKEHNLRELGLRFMLMNENGMSKSEIAKAEGISNAKVTRAF
QAAAVPAEFIELFPVVSELTLQDYQLLLDVWEEAKAEAVEVSALVSEIQQKLNEDDLLRI
TNPDDKKSAILNGFKSARRQLKKPAPVSKTVTEKLATFTTANTYARRKTNDEKRTVQYEF
SRLPKEIAEQIDASIRQILSTLN