Protein Info for IAI47_21865 in Pantoea sp. MT58

Annotation: carbohydrate porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF11471: Sugarporin_N" amino acids 27 to 57 (31 residues), 32.2 bits, see alignment (E = 1e-11) PF02264: LamB" amino acids 103 to 511 (409 residues), 330.8 bits, see alignment E=2.2e-102

Best Hits

Swiss-Prot: 69% identical to SCRY_SALTM: Sucrose porin (scrY) from Salmonella typhimurium

KEGG orthology group: K02024, maltoporin (inferred from 94% identity to pva:Pvag_pPag10155)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>IAI47_21865 carbohydrate porin (Pantoea sp. MT58)
MKKSTLAVALSLIFFSTSVWADSSMSSIEARLAAMERRLQAAEQRANVAETRAQVAEKQA
QVAEKQAQQLAAVQQQTQTSTAEVAQRTAKLEQKSADEGGFEFHGYARSGLLMNSSATKT
QGGPTLTPAGETGGHVGRLGNEPDTYVELNLEHKQTLDNGATTRFKAMLADGQRTYNDWT
ASSSDLNLRQAFVELGQLPTFSGAFDNSTVWAGKRFDRDNFDIHWIDSDVVFLAGTGAGI
YDMKWSDQTRSNISLYGRTFGDIENNENTAQNYILTLNNFVGPVQMMLSGMRAKDNDDRR
DIDGLRVKGDAAETGVHALLGLHNDSFYGLTEGTSKTALLYGHGLGAEVKSIGSDGALLP
EANTWRLASYGITPLGGGWHIAPAVLAQRSDDRYVKGDSYDWATVNLRLIQEITQNFEMQ
YEGSYQYMDLRPEGYNNRNAVSGSFTKLTIAPTLKAGDVGDFLKRPEIRLFATWMNWDHR
LNNYASDDAFGSKGFDAGGEWNFGVQMEIWF