Protein Info for IAI47_21840 in Pantoea sp. MT58

Annotation: chorismate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01806: putative chorismate mutase
  • amino acids 24 to 136 (113 residues), 137.2 bits, E=1.3e-44
• PF01817: CM_2
  • amino acids 33 to 99 (67 residues), 54.3 bits, E=7.1e-19

Best Hits

Swiss-Prot: 87% identical to CHMU_ENTAG: Monofunctional chorismate mutase (aroQ) from Enterobacter agglomerans

KEGG orthology group: None (inferred from 83% identity to pva:Pvag_pPag10150)

Predicted SEED Role

"Periplasmic chorismate mutase I precursor (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-phenylalanine biosynthesis II (3/4 steps found)
• L-tyrosine biosynthesis III (3/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (3/5 steps found)
• L-tyrosine biosynthesis II (2/4 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.5

Use Curated BLAST to search for 5.4.99.5

Protein Sequence (181 amino acids)

>IAI47_21840 chorismate mutase (Pantoea sp. MT58)
MTHFVAIFFSSLFMCSNVFAGSVSSVSMSALSGALNERMQVMKVVAGYKAQHHLPIEDLP
REQVVLDHMLQNAEQAGLEPHSVEPFVHALMNASKAVQYRYRADWLSVPDSDRPIPDLAE
TRQQIEKLDTQLLTAISQRLMTGIFSQEDKAFLMSQLTAPHLSQQDKNSLFASLGRIKRL
R