Protein Info for IAI47_21760 in Pantoea sp. MT58

Annotation: CitMHS family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 97 to 125 (29 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 239 to 269 (31 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 319 to 344 (26 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 412 to 435 (24 residues), see Phobius details TIGR00784: citrate transporter" amino acids 1 to 432 (432 residues), 583.2 bits, see alignment E=2.1e-179 PF03600: CitMHS" amino acids 13 to 380 (368 residues), 125.5 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: K03300, citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family (inferred from 99% identity to pva:Pvag_pPag10123)

Predicted SEED Role

"citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>IAI47_21760 CitMHS family transporter (Pantoea sp. MT58)
MLTILGFTMVVCFMYLIMTKRMSALIALILIPTIFALIGGFYAGLGDMMLDGVKKLAPTG
VMLTFSILYFGLMIDAGLFDPLVRFILRMVRGDPLKVLVGTAVLTLLVSLDGDSSTTYMI
AIAAFLPLYHRLGMNVLMMTCLVNLASGIMNLSPWGGPTARAAAALRIDALDIFIPMLPA
MLLACVSLVAMAVLFGLRERKRLGVMTMKDDHLDNIELGLGDAEECAANRRPKMFWPNFI
LTTVLLVLLVVGLMPIQILFMLAFAIAVMLNYPTLEEQKARISSHAGNVLAVTALIFAAG
IFTGILSGTGMVDAMAKSLLAVIPHSFGPYLAVFTALVSLPFTFFMSNDAFYFGILPVIA
QTAASYGITAEEIARASIVGQPFHLLSPLVPSVYLLVGLAKVDIGDHQRFAIKWGILVSL
VLMAGGLLTGAFPLFHR