Protein Info for IAI47_21745 in Pantoea sp. MT58

Annotation: acetolactate synthase AlsS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02418: acetolactate synthase, catabolic
  • amino acids 13 to 550 (538 residues), 864 bits, E=2e-264
• PF02776: TPP_enzyme_N
  • amino acids 13 to 127 (115 residues), 120.1 bits, E=7.3e-39
• PF00205: TPP_enzyme_M
  • amino acids 197 to 331 (135 residues), 93.7 bits, E=1.2e-30
• PF02775: TPP_enzyme_C
  • amino acids 393 to 539 (147 residues), 143.3 bits, E=8.3e-46

Best Hits

Swiss-Prot: 79% identical to ILVB_KLEPN: Acetolactate synthase, catabolic (budB) from Klebsiella pneumoniae

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 97% identity to pva:Pvag_pPag10120)

MetaCyc: 79% identical to catabolic acetolactate synthase (Klebsiella pneumoniae)
Acetolactate synthase. [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase, catabolic (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Alpha-acetolactate operon (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• superpathway of (R,R)-butanediol biosynthesis (5/5 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to (R)-acetoin I (3/3 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (5/6 steps found)
• pyruvate fermentation to (R)-acetoin II (2/2 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Protein Sequence (559 amino acids)

>IAI47_21745 acetolactate synthase AlsS (Pantoea sp. MT58)
MKTSTDTTLWTCGADLVVAQLEAQGVQHVFGIPGAKIDKVFDSLLDSSIQTIPVRHEANA
AFMAAAVGRLTGNAGVALVTSGPGCSNLITGMATATSEGDPVVAIGGQVKRSDSAKQVHQ
SMDTVSMFRPITKYAVEVTDPSALSECLSNAFRHAEHGRGGGAFISLPQDIVDQPVTGKA
LSSKGRPVLGAAPDAMIEAVSRAIAGAKNPVILLGLMASQTENSEAIDELLTRSHIPVTS
TYQAAGAVRQDHFSRFAGRVGLFNNQAGDRLLQQADLIMTIGYSPVEYEPAMWNSGNATL
IHIDVIPAETDNRYLPDAELVGDIAATVRKLAARITAPRQLTAETASILDDRQQQRKLLA
MQGASLNQFALHPLRIVRAMQDIINSDVSLTVDMGSFHIWIARYLYSFRARQIMISNGQQ
TMGVALPWAIGAWLVDPQRKVVSVSGDGGFLQSSMELETAVRLKANILHIVWVDNAYNMV
AMQEEKKYHRVSGVHFGPIDFKAYAEAFGAAGFAVTSAAELEPTLRKAMDVQGPAVVAVP
VDYADNPLLMGQLHLSQLL