Protein Info for IAI47_21740 in Pantoea sp. MT58

Annotation: acetolactate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01252: alpha-acetolactate decarboxylase
  • amino acids 29 to 258 (230 residues), 291.1 bits, E=2.8e-91
• PF03306: AAL_decarboxy
  • amino acids 30 to 247 (218 residues), 282.5 bits, E=9.6e-89

Best Hits

Swiss-Prot: 69% identical to ALDC_KLEAE: Alpha-acetolactate decarboxylase (budA) from Klebsiella aerogenes

KEGG orthology group: K01575, acetolactate decarboxylase [EC: 4.1.1.5] (inferred from 98% identity to pva:Pvag_pPag10119)

MetaCyc: 69% identical to alpha-acetolactate decarboxylase (Klebsiella aerogenes)
Acetolactate decarboxylase. [EC: 4.1.1.5]

Predicted SEED Role

"Alpha-acetolactate decarboxylase (EC 4.1.1.5)" in subsystem Acetoin, butanediol metabolism or Alpha-acetolactate operon (EC 4.1.1.5)

MetaCyc Pathways

• superpathway of (R,R)-butanediol biosynthesis (5/5 steps found)
• pyruvate fermentation to (R)-acetoin II (2/2 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• C5-Branched dibasic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.5

Protein Sequence (260 amino acids)

>IAI47_21740 acetolactate decarboxylase (Pantoea sp. MT58)
MSNCVTDCSCEDQLKHTVLTLSQDAPESVIYQTSLMSALLSGVYDGNVRIADLLRKGDFG
LGTFNRLDGEMIAFDSKVYQLHADGSAHPADPAQKTPFAVMTFFKPQHLFEFDRPMSRED
IHRVIDSEITSDNQFCALRISGRFSRVDTRTVPCQCRPYRSMPEVLDDQPTFSFSQRAGE
LIGFRTPQYMQGINVAGYHEHFITDDREGGGHILDYALEQGTLTFGAISKLVVDLPQDSD
FLNADLNPANLDAAIRAVES