Protein Info for IAI47_21725 in Pantoea sp. MT58

Annotation: efflux RND transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1014 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details amino acids 466 to 495 (30 residues), see Phobius details amino acids 525 to 545 (21 residues), see Phobius details amino acids 857 to 875 (19 residues), see Phobius details amino acids 883 to 902 (20 residues), see Phobius details amino acids 908 to 929 (22 residues), see Phobius details amino acids 959 to 978 (20 residues), see Phobius details amino acids 984 to 1007 (24 residues), see Phobius details PF00873: ACR_tran" amino acids 12 to 1003 (992 residues), 527.4 bits, see alignment E=3.4e-162

Best Hits

KEGG orthology group: None (inferred from 92% identity to pva:Pvag_pPag10116)

Predicted SEED Role

"RND efflux transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1014 amino acids)

>IAI47_21725 efflux RND transporter permease subunit (Pantoea sp. MT58)
MKKPAGFNLSGWALAHQQLVIFFMLLVMAAGVLSYERLSRNEDPAFTIKTAVISAQWPGA
DVDNMVQLVTDVLEQKVQEIPSLDAVESETRAGQTVIYVNLRDDTPPSQVAGTWYQLRKK
MKDVAASLPQGVQGPAVNDEFDDTFGTIYGFTADGFTARELRDRVDNLRRSLTSLPDIGK
TTLLGVQEQQVVIAFSPRKLNGMGLDLQQVSDAIKAQNDVVPAGSLRTDRENIALRVSGT
LTSVENLRAITLHIGERFIPLTELATITLQPADPPAPTFRVNGVPAIGLAISMAPGGNML
DFGKQLNQRMQTLASQLPHGITLTRVADQSSVVKNAVSGFVRILGEAVVIVLAVSFVSLG
LRAGLVVAAAIPLVLAMTFTGMLLAGIGLQRISLGALIIALGLLVDDAMITVEAMVARLE
AGDSKWQAATYAFKTTAFPMLTGTLVMIAGFIPVGFAASSAGEYCYSLFVVIALALLCSW
VVAVIFSPLTGCWLLSAKHITAHPSPGVLARTYHRLLDVILRNRLVTMGVAMAVLLVSLY
ATTFMQGEFFPASDRPELLVSLTLPANAAQAETLRRTVQLEKMLQNDRDVANFTSYVGSG
AIRFYLPMDVLLDNENIAQLVVVAKDLTVRDRLRSRLERKLAADFNDISTRVSPLELGPP
VGWPLKYRITGPDNAQVRQVADRLAAQLARSPLTRGVNLTAGEPERVIRLAVNQTAARAA
GLSSDTIATALNTLMSGSVVTTLRDRNRLIDVVLRGDDKARQDTDLLAGLMITNASGQKI
PLRQVATLNWGVDDPVIWRRQRLAYITVQTDIAPGQRAEQVSQQLAPGVAALRASLPAGY
GIEEGGVAAESDKGNGSVFALLPVTICAMLILLMIQLQRFSGMLLALSMAPFGLPGIISA
MLPAGTPLGFVALLGIIALAGIIIRNAVIMISEVDTNSRAGLAAGEAIRQAAHHRARPIV
LTACAAILGMIPISHQVFWGPMALAIIGGLVSGTLVTLTVLPAALSLMMERRSR