Protein Info for IAI47_21595 in Pantoea sp. MT58

Annotation: 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 40 to 63 (24 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details

Best Hits

Swiss-Prot: 56% identical to ARNF_ERWT9: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K12963, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF (inferred from 91% identity to pva:Pvag_pPag10066)

Predicted SEED Role

"Polymyxin resistance protein PmrM" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>IAI47_21595 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase (Pantoea sp. MT58)
MKGYGWVTCSVLLVSAAQLMMRWAMPRLPDVSSLTSLPTVAILPALLLLAGLGAYAVSML
CWIRALHYFPLNRVYPLLSLSYVLVWLVAVCLPVFHEAFSWRSLAGVVIIVIGLLCIVVK
P